CELF1 Rabbit mAb, Unconjugated

Catalog Number: ABB-A1150
Article Name: CELF1 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A1150
Supplier Catalog Number: A1150
Alternative Catalog Number: ABB-A1150-100UL,ABB-A1150-20UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IP, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CUGBP, NAB50, NAPOR, CUG-BP, CUGBP1, hNab50, BRUNOL2, EDEN-BP, CELF1
Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene. Alternative splicing results in multiple transcript variants encoding different isoforms.
Clonality: Monoclonal
Clone Designation: [ARC1866]
Molecular Weight: 52kDa
NCBI: 10658
UniProt: Q92879
Purity: Affinity purification
Sequence: MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSE
Target: CELF1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Neuroscience,Neurodegenerative Diseases