beta-Catenin Rabbit pAb, Unconjugated

Artikelnummer: ABB-A11512
Artikelname: beta-Catenin Rabbit pAb, Unconjugated
Artikelnummer: ABB-A11512
Hersteller Artikelnummer: A11512
Alternativnummer: ABB-A11512-20UL,ABB-A11512-100UL,ABB-A11512-1000UL,ABB-A11512-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: EVR7, CTNNB, MRD19, NEDSDV, armadillo, beta-Catenin
The protein encoded by this gene is part of a complex of proteins that constitute adherens junctions (AJs). AJs are necessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion between cells. The encoded protein also anchors the actin cytoskeleton and may be responsible for transmitting the contact inhibition signal that causes cells to stop dividing once the epithelial sheet is complete. Finally, this protein binds to the product of the APC gene, which is mutated in adenomatous polyposis of the colon. Mutations in this gene are a cause of colorectal cancer (CRC), pilomatrixoma (PTR), medulloblastoma (MDB), and ovarian cancer. Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 85kDa
NCBI: 1499
UniProt: P35222
Reinheit: Affinity purification
Sequenz: PQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL
Target-Kategorie: CTNNB1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:100 - 1:500|IHC-P,1:20 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Protein phosphorylation,Cancer,Invasion and Metastasis,Signal Transduction,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Cell Adhesion,Cadherins,Tight Junctions,Cytoskeleton,Microfilaments,Wnt -Catenin Signaling Pathway,ESC Pluripotency and Differentiation,Immunology Inflammation,Neuroscience,Stem Cells,Cardiovascular,Angiogenesis