beta-Catenin Rabbit pAb, Unconjugated

Catalog Number: ABB-A11512
Article Name: beta-Catenin Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A11512
Supplier Catalog Number: A11512
Alternative Catalog Number: ABB-A11512-20UL,ABB-A11512-100UL,ABB-A11512-1000UL,ABB-A11512-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, IP, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: EVR7, CTNNB, MRD19, NEDSDV, armadillo, beta-Catenin
The protein encoded by this gene is part of a complex of proteins that constitute adherens junctions (AJs). AJs are necessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion between cells. The encoded protein also anchors the actin cytoskeleton and may be responsible for transmitting the contact inhibition signal that causes cells to stop dividing once the epithelial sheet is complete. Finally, this protein binds to the product of the APC gene, which is mutated in adenomatous polyposis of the colon. Mutations in this gene are a cause of colorectal cancer (CRC), pilomatrixoma (PTR), medulloblastoma (MDB), and ovarian cancer. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 85kDa
NCBI: 1499
UniProt: P35222
Purity: Affinity purification
Sequence: PQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL
Target: CTNNB1
Antibody Type: Primary Antibody
Application Dilute: WB,1:100 - 1:500|IHC-P,1:20 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Protein phosphorylation,Cancer,Invasion and Metastasis,Signal Transduction,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Cell Adhesion,Cadherins,Tight Junctions,Cytoskeleton,Microfilaments,Wnt -Catenin Signaling Pathway,ESC Pluripotency and Differentiation,Immunology Inflammation,Neuroscience,Stem Cells,Cardiovascular,Angiogenesis