MTCO2 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A11522
Artikelname: MTCO2 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A11522
Hersteller Artikelnummer: A11522
Alternativnummer: ABB-A11522-100UL,ABB-A11522-20UL,ABB-A11522-500UL,ABB-A11522-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Mouse
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: COX2, MTCO2
Predicted to enable copper ion binding activity and oxidoreductase activity. Predicted to contribute to cytochrome-c oxidase activity. Predicted to be involved in ATP synthesis coupled electron transport, positive regulation of cellular biosynthetic process, and positive regulation of necrotic cell death. Located in mitochondrion. Is expressed in embryo, epiblast, heart, liver, and metanephros. Orthologous to several human genes including MTCO2P12 (MT-CO2 pseudogene 12).
Klonalität: Polyclonal
Molekulargewicht: 26kDa
NCBI: 17709
UniProt: P00403
Reinheit: Affinity purification
Sequenz: GHQWYWSYEYTDYEDLCFDSYMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQATVTSNRPGLFYGQCSEIC
Target-Kategorie: mt-Co2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:100 - 1:500|IF/ICC,1:50 - 200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine & Metabolism,Mitochondrial metabolism,Cytochromes,Mitochondrial markers,Oxidative phosphorylation,Neuroscience,Neurodegenerative Diseases