MTCO2 Rabbit pAb, Unconjugated

Product Overview

• Article Name: MTCO2 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A11522
• Supplier Catalog Number: A11522
• Alternative Catalog Number: ABB-A11522-100UL,ABB-A11522-20UL,ABB-A11522-500UL,ABB-A11522-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Mouse
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: COX2, MTCO2

Product Description

Predicted to enable copper ion binding activity and oxidoreductase activity. Predicted to contribute to cytochrome-c oxidase activity. Predicted to be involved in ATP synthesis coupled electron transport, positive regulation of cellular biosynthetic process, and positive regulation of necrotic cell death. Located in mitochondrion. Is expressed in embryo, epiblast, heart, liver, and metanephros. Orthologous to several human genes including MTCO2P12 (MT-CO2 pseudogene 12).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 26kDa
• NCBI: 17709
• UniProt: P00403
• Purity: Affinity purification
• Sequence: GHQWYWSYEYTDYEDLCFDSYMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQATVTSNRPGLFYGQCSEIC
• Target: mt-Co2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IHC-P,1:100 - 1:500|IF/ICC,1:50 - 200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse,Rat, ResearchArea: Cancer,Signal Transduction,Endocrine & Metabolism,Mitochondrial metabolism,Cytochromes,Mitochondrial markers,Oxidative phosphorylation,Neuroscience,Neurodegenerative Diseases.

Images