BCL3 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A11582
Artikelname: BCL3 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A11582
Hersteller Artikelnummer: A11582
Alternativnummer: ABB-A11582-20UL,ABB-A11582-100UL,ABB-A11582-1000UL,ABB-A11582-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: BCL4, D19S37, BCL3
This gene is a proto-oncogene candidate. It is identified by its translocation into the immunoglobulin alpha-locus in some cases of B-cell leukemia. The protein encoded by this gene contains seven ankyrin repeats, which are most closely related to those found in I kappa B proteins. This protein functions as a transcriptional co-activator that activates through its association with NF-kappa B homodimers. The expression of this gene can be induced by NF-kappa B, which forms a part of the autoregulatory loop that controls the nuclear residence of p50 NF-kappa B.
Klonalität: Polyclonal
Molekulargewicht: 48kDa
NCBI: 602
UniProt: P20749
Reinheit: Affinity purification
Sequenz: ANVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRGKATRPASTSQPDPSPDRSANTSPESSSRLSSNGLLSASPS
Target-Kategorie: BCL3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cancer,Cell Biology Developmental Biology,Apoptosis,Immunology Inflammation,NF-kB Signaling Pathway