BCL3 Rabbit pAb, Unconjugated

Catalog Number: ABB-A11582
Article Name: BCL3 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A11582
Supplier Catalog Number: A11582
Alternative Catalog Number: ABB-A11582-20UL,ABB-A11582-100UL,ABB-A11582-1000UL,ABB-A11582-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: BCL4, D19S37, BCL3
This gene is a proto-oncogene candidate. It is identified by its translocation into the immunoglobulin alpha-locus in some cases of B-cell leukemia. The protein encoded by this gene contains seven ankyrin repeats, which are most closely related to those found in I kappa B proteins. This protein functions as a transcriptional co-activator that activates through its association with NF-kappa B homodimers. The expression of this gene can be induced by NF-kappa B, which forms a part of the autoregulatory loop that controls the nuclear residence of p50 NF-kappa B.
Clonality: Polyclonal
Molecular Weight: 48kDa
NCBI: 602
UniProt: P20749
Purity: Affinity purification
Sequence: ANVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRGKATRPASTSQPDPSPDRSANTSPESSSRLSSNGLLSASPS
Target: BCL3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cancer,Cell Biology Developmental Biology,Apoptosis,Immunology Inflammation,NF-kB Signaling Pathway.