FABP7 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A11604
Artikelname: FABP7 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A11604
Hersteller Artikelnummer: A11604
Alternativnummer: ABB-A11604-100UL,ABB-A11604-20UL,ABB-A11604-500UL,ABB-A11604-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MRG, BLBP, FABPB, B-FABP, FABP7
The gene encodes a small, highly conserved cytoplasmic protein that bind long-chain fatty acids and other hydrophobic ligands. The encoded protein is important in the establishment of the radial glial fiber in the developing brain. Alternative splicing and promoter usage results in multiple transcript variants encoding different isoforms. Pseudogenes of this gene are found on multiple chromosomes.
Klonalität: Polyclonal
Molekulargewicht: 15kDa
NCBI: 2173
UniProt: O15540
Reinheit: Affinity purification
Sequenz: MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA
Target-Kategorie: FABP7
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Neuroscience