FABP7 Rabbit pAb, Unconjugated

Catalog Number: ABB-A11604
Article Name: FABP7 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A11604
Supplier Catalog Number: A11604
Alternative Catalog Number: ABB-A11604-100UL,ABB-A11604-20UL,ABB-A11604-500UL,ABB-A11604-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MRG, BLBP, FABPB, B-FABP, FABP7
The gene encodes a small, highly conserved cytoplasmic protein that bind long-chain fatty acids and other hydrophobic ligands. The encoded protein is important in the establishment of the radial glial fiber in the developing brain. Alternative splicing and promoter usage results in multiple transcript variants encoding different isoforms. Pseudogenes of this gene are found on multiple chromosomes.
Clonality: Polyclonal
Molecular Weight: 15kDa
NCBI: 2173
UniProt: O15540
Purity: Affinity purification
Sequence: MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA
Target: FABP7
Antibody Type: Primary Antibody
Application Dilute: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Rat, ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Neuroscience.