SEC61A1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: SEC61A1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A11614
• Hersteller Artikelnummer: A11614
• Alternativnummer: ABB-A11614-100UL,ABB-A11614-20UL,ABB-A11614-500UL,ABB-A11614-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: HNFJ4, SEC61, ADTKD5, HSEC61, SEC61A, SEC61A1

Produktbeschreibung

The protein encoded by this gene belongs to the SECY/SEC61- alpha family. It appears to play a crucial role in the insertion of secretory and membrane polypeptides into the endoplasmic reticulum. This protein found to be tightly associated with membrane-bound ribosomes, either directly or through adaptor proteins. This gene encodes an alpha subunit of the heteromeric SEC61 complex, which also contains beta and gamma subunits.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 52kDa
• NCBI: 29927
• UniProt: P61619
• Reinheit: Affinity purification
• Sequenz: ARFSGNLLVSLLGTWSDTSSGGPARAYPVGGLCYYLSPPESFGSVLEDPVHAVVYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTA
• Target-Kategorie: SEC61A1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction

Bilder