SEC61A1 Rabbit pAb, Unconjugated

Product Overview

• Article Name: SEC61A1 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A11614
• Supplier Catalog Number: A11614
• Alternative Catalog Number: ABB-A11614-100UL,ABB-A11614-20UL,ABB-A11614-500UL,ABB-A11614-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: HNFJ4, SEC61, ADTKD5, HSEC61, SEC61A, SEC61A1

Product Description

The protein encoded by this gene belongs to the SECY/SEC61- alpha family. It appears to play a crucial role in the insertion of secretory and membrane polypeptides into the endoplasmic reticulum. This protein found to be tightly associated with membrane-bound ribosomes, either directly or through adaptor proteins. This gene encodes an alpha subunit of the heteromeric SEC61 complex, which also contains beta and gamma subunits.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 52kDa
• NCBI: 29927
• UniProt: P61619
• Purity: Affinity purification
• Sequence: ARFSGNLLVSLLGTWSDTSSGGPARAYPVGGLCYYLSPPESFGSVLEDPVHAVVYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTA
• Target: SEC61A1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction.

Images