NEDD8 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: NEDD8 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A1163
• Hersteller Artikelnummer: A1163
• Alternativnummer: ABB-A1163-100UL,ABB-A1163-20UL,ABB-A1163-500UL,ABB-A1163-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: NEDD-8, NEDD8

Produktbeschreibung

Enables ubiquitin protein ligase binding activity. Acts upstream of or within protein neddylation. Located in cytosol and nucleoplasm. Biomarker of Parkinsons disease and malignant astrocytoma.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 9kDa
• NCBI: 4738
• UniProt: Q15843
• Reinheit: Affinity purification
• Sequenz: MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ
• Target-Kategorie: NEDD8
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cell Biology Developmental Biology,Ubiquitin.