NEDD8 Rabbit pAb, Unconjugated

Product Overview

• Article Name: NEDD8 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A1163
• Supplier Catalog Number: A1163
• Alternative Catalog Number: ABB-A1163-100UL,ABB-A1163-20UL,ABB-A1163-500UL,ABB-A1163-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: NEDD-8, NEDD8

Product Description

Enables ubiquitin protein ligase binding activity. Acts upstream of or within protein neddylation. Located in cytosol and nucleoplasm. Biomarker of Parkinsons disease and malignant astrocytoma.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 9kDa
• NCBI: 4738
• UniProt: Q15843
• Purity: Affinity purification
• Sequence: MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ
• Target: NEDD8
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cell Biology Developmental Biology,Ubiquitin.