beta 2 Microglobulin Rabbit mAb, Unconjugated

Artikelnummer: ABB-A11642
Artikelname: beta 2 Microglobulin Rabbit mAb, Unconjugated
Artikelnummer: ABB-A11642
Hersteller Artikelnummer: A11642
Alternativnummer: ABB-A11642-20UL,ABB-A11642-100UL,ABB-A11642-500UL,ABB-A11642-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: IMD43, beta 2 Microglobulin
This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fibrils in some pathological conditions. The encoded antimicrobial protein displays antibacterial activity in amniotic fluid. A mutation in this gene has been shown to result in hypercatabolic hypoproteinemia.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0656]
Molekulargewicht: 14kDa
NCBI: 567
UniProt: P61769
Reinheit: Affinity purification
Sequenz: SNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
Target-Kategorie: B2M
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:3000 - 1:18000|IF-P,1:200 - 1:2000|IHC-P,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Tumor biomarkers,Cardiovascular,Blood,Serum Proteins.