beta 2 Microglobulin Rabbit mAb, Unconjugated

Catalog Number: ABB-A11642
Article Name: beta 2 Microglobulin Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A11642
Supplier Catalog Number: A11642
Alternative Catalog Number: ABB-A11642-20UL,ABB-A11642-100UL,ABB-A11642-500UL,ABB-A11642-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: IMD43, beta 2 Microglobulin
This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fibrils in some pathological conditions. The encoded antimicrobial protein displays antibacterial activity in amniotic fluid. A mutation in this gene has been shown to result in hypercatabolic hypoproteinemia.
Clonality: Monoclonal
Clone Designation: [ARC0656]
Molecular Weight: 14kDa
NCBI: 567
UniProt: P61769
Purity: Affinity purification
Sequence: SNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
Target: B2M
Antibody Type: Primary Antibody
Application Dilute: WB,1:3000 - 1:18000|IF-P,1:200 - 1:2000|IHC-P,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Tumor biomarkers,Cardiovascular,Blood,Serum Proteins.