FBP1 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A11664
Artikelname: FBP1 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A11664
Hersteller Artikelnummer: A11664
Alternativnummer: ABB-A11664-100UL,ABB-A11664-20UL,ABB-A11664-500UL,ABB-A11664-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: FBP, FBP1
Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0664]
Molekulargewicht: 37 kDa
NCBI: 2203
UniProt: P09467
Reinheit: Affinity purification
Sequenz: APYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHSAQ
Target-Kategorie: FBP1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:6000|IF/ICC,1:100 - 1:400|IF-P,1:100 - 1:400|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair,Cancer,Signal Transduction,Endocrine Metabolism,Nucleotide metabolism,Carbohydrate metabolism.