FBP1 Rabbit mAb, Unconjugated

Catalog Number: ABB-A11664
Article Name: FBP1 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A11664
Supplier Catalog Number: A11664
Alternative Catalog Number: ABB-A11664-100UL,ABB-A11664-20UL,ABB-A11664-500UL,ABB-A11664-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: FBP, FBP1
Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.
Clonality: Monoclonal
Clone Designation: [ARC0664]
Molecular Weight: 37 kDa
NCBI: 2203
UniProt: P09467
Purity: Affinity purification
Sequence: APYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHSAQ
Target: FBP1
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:6000|IF/ICC,1:100 - 1:400|IF-P,1:100 - 1:400|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair,Cancer,Signal Transduction,Endocrine Metabolism,Nucleotide metabolism,Carbohydrate metabolism.