CD168/RHAMM Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: CD168/RHAMM Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A11666
• Hersteller Artikelnummer: A11666
• Alternativnummer: ABB-A11666-100UL,ABB-A11666-20UL,ABB-A11666-500UL,ABB-A11666-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CD168, IHABP, RHAMM, CD168/RHAMM

Produktbeschreibung

The protein encoded by this gene is involved in cell motility. It is expressed in breast tissue and together with other proteins, it forms a complex with BRCA1 and BRCA2, thus is potentially associated with higher risk of breast cancer. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC0667]
• Molekulargewicht: 84kDa
• NCBI: 3161
• UniProt: O75330
• Reinheit: Affinity purification
• Sequenz: MSFPKAPLKRFNDPSGCAPSPGAYDVKTLEVLKGPVSFQKSQRFKQQKESKQNLNVDKDTTLPASARKVKSSESKESQKNDKDLKILEKEIRVLLQERGA
• Target-Kategorie: HMMR
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse, ResearchArea: Cancer,Tumor immunology,Cell Biology Developmental Biology,Immunology Inflammation,CDs,Stem Cells,Embryonic Stem Cells.

Bilder