CD168/RHAMM Rabbit mAb, Unconjugated

Product Overview

• Article Name: CD168/RHAMM Rabbit mAb, Unconjugated
• Biozol Catalog Number: ABB-A11666
• Supplier Catalog Number: A11666
• Alternative Catalog Number: ABB-A11666-100UL,ABB-A11666-20UL,ABB-A11666-500UL,ABB-A11666-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CD168, IHABP, RHAMM, CD168/RHAMM

Product Description

The protein encoded by this gene is involved in cell motility. It is expressed in breast tissue and together with other proteins, it forms a complex with BRCA1 and BRCA2, thus is potentially associated with higher risk of breast cancer. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

Product Properties

• Clonality: Monoclonal
• Clone Designation: [ARC0667]
• Molecular Weight: 84kDa
• NCBI: 3161
• UniProt: O75330
• Purity: Affinity purification
• Sequence: MSFPKAPLKRFNDPSGCAPSPGAYDVKTLEVLKGPVSFQKSQRFKQQKESKQNLNVDKDTTLPASARKVKSSESKESQKNDKDLKILEKEIRVLLQERGA
• Target: HMMR
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse, ResearchArea: Cancer,Tumor immunology,Cell Biology Developmental Biology,Immunology Inflammation,CDs,Stem Cells,Embryonic Stem Cells.

Images