RAB11A Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: RAB11A Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A1167
• Hersteller Artikelnummer: A1167
• Alternativnummer: ABB-A1167-20UL,ABB-A1167-100UL,ABB-A1167-1000UL,ABB-A1167-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: YL8, RAB11A

Produktbeschreibung

The protein encoded by this gene belongs to the Rab family of the small GTPase superfamily. It is associated with both constitutive and regulated secretory pathways, and may be involved in protein transport. Two transcript variants encoding different isoforms have been found for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 24kDa
• NCBI: 8766
• UniProt: P62491
• Reinheit: Affinity purification
• Sequenz: ENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHV
• Target-Kategorie: RAB11A
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Rat. ResearchArea: Cancer,Signal Transduction,G protein signaling,Small G proteins

Bilder