RAB11A Rabbit pAb, Unconjugated

Product Overview

• Article Name: RAB11A Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A1167
• Supplier Catalog Number: A1167
• Alternative Catalog Number: ABB-A1167-20UL,ABB-A1167-100UL,ABB-A1167-1000UL,ABB-A1167-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: YL8, RAB11A

Product Description

The protein encoded by this gene belongs to the Rab family of the small GTPase superfamily. It is associated with both constitutive and regulated secretory pathways, and may be involved in protein transport. Two transcript variants encoding different isoforms have been found for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 24kDa
• NCBI: 8766
• UniProt: P62491
• Purity: Affinity purification
• Sequence: ENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHV
• Target: RAB11A
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Rat, ResearchArea: Cancer,Signal Transduction,G protein signaling,Small G proteins.

Images