OLA1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: OLA1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A11671
• Hersteller Artikelnummer: A11671
• Alternativnummer: ABB-A11671-20UL,ABB-A11671-100UL,ABB-A11671-500UL,ABB-A11671-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: DOC45, GBP45, GTBP9, GTPBP9, PTD004, OLA1

Produktbeschreibung

This gene encodes a member of the GTPase protein family. The encoded protein interacts with breast cancer-associated gene 1 (BRCA1) and BRCA1-associated RING domain protein (BARD1), and is involved in centrosome regulation. Overexpression of this gene has been observed in multiple types of cancer and may be associated with poor survival. Pseudogenes of this gene have been defined on chromosomes 17 and 22.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 45kDa
• NCBI: 29789
• UniProt: Q9NTK5
• Reinheit: Affinity purification
• Sequenz: DDITHVEGSVDPIRDIEIIHEELQLKDEEMIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFT
• Target-Kategorie: OLA1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology

Bilder