OLA1 Rabbit pAb, Unconjugated

Product Overview

• Article Name: OLA1 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A11671
• Supplier Catalog Number: A11671
• Alternative Catalog Number: ABB-A11671-20UL,ABB-A11671-100UL,ABB-A11671-500UL,ABB-A11671-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: DOC45, GBP45, GTBP9, GTPBP9, PTD004, OLA1

Product Description

This gene encodes a member of the GTPase protein family. The encoded protein interacts with breast cancer-associated gene 1 (BRCA1) and BRCA1-associated RING domain protein (BARD1), and is involved in centrosome regulation. Overexpression of this gene has been observed in multiple types of cancer and may be associated with poor survival. Pseudogenes of this gene have been defined on chromosomes 17 and 22.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 45kDa
• NCBI: 29789
• UniProt: Q9NTK5
• Purity: Affinity purification
• Sequence: DDITHVEGSVDPIRDIEIIHEELQLKDEEMIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFT
• Target: OLA1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Cell Biology Developmental Biology.

Images