SLC12A2 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: SLC12A2 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A11675
• Hersteller Artikelnummer: A11675
• Alternativnummer: ABB-A11675-100UL,ABB-A11675-20UL,ABB-A11675-500UL,ABB-A11675-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: BSC, BSC2, CCC1, BSC-2, KILQS, NKCC1, PPP1R141, SLC12A2

Produktbeschreibung

The protein encoded by this gene mediates sodium and chloride transport and reabsorption. The encoded protein is a membrane protein and is important in maintaining proper ionic balance and cell volume. This protein is phosphorylated in response to DNA damage. Three transcript variants encoding two different isoforms have been found for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 131kDa
• NCBI: 6558
• UniProt: P55011
• Reinheit: Affinity purification
• Sequenz: GEASGESEPAKGSEEAKGRFRVNFVDPAASSSAEDSLSDAAGVGVDGPNVSFQNGGDTVLSEGSSLHSGGGGGSGHHQHYYYDTHTNTYYLRTFGHNTMDAVPRIDHYRHTAAQLGEKLLRPSLAELHDELEKEPFEDGFANGEESTPTRDAVVTYTAESK
• Target-Kategorie: SLC12A2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Neuroscience,Cardiovascular,Hypoxia

Bilder