SLC12A2 Rabbit pAb, Unconjugated

Product Overview

• Article Name: SLC12A2 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A11675
• Supplier Catalog Number: A11675
• Alternative Catalog Number: ABB-A11675-100UL,ABB-A11675-20UL,ABB-A11675-500UL,ABB-A11675-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: BSC, BSC2, CCC1, BSC-2, KILQS, NKCC1, PPP1R141, SLC12A2

Product Description

The protein encoded by this gene mediates sodium and chloride transport and reabsorption. The encoded protein is a membrane protein and is important in maintaining proper ionic balance and cell volume. This protein is phosphorylated in response to DNA damage. Three transcript variants encoding two different isoforms have been found for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 131kDa
• NCBI: 6558
• UniProt: P55011
• Purity: Affinity purification
• Sequence: GEASGESEPAKGSEEAKGRFRVNFVDPAASSSAEDSLSDAAGVGVDGPNVSFQNGGDTVLSEGSSLHSGGGGGSGHHQHYYYDTHTNTYYLRTFGHNTMDAVPRIDHYRHTAAQLGEKLLRPSLAELHDELEKEPFEDGFANGEESTPTRDAVVTYTAESK
• Target: SLC12A2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Neuroscience,Cardiovascular,Hypoxia.

Images