CD127/IL7R Rabbit mAb, Unconjugated

Artikelnummer: ABB-A11678
Artikelname: CD127/IL7R Rabbit mAb, Unconjugated
Artikelnummer: ABB-A11678
Hersteller Artikelnummer: A11678
Alternativnummer: ABB-A11678-20UL,ABB-A11678-100UL,ABB-A11678-500UL,ABB-A11678-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ILRA, CD127, IL7RA, CDW127, IMD104, sIL-7R, lnc-IL7R, IL7Ralpha, IL-7Ralpha, IL-7R-alpha, CD127/IL7R
The protein encoded by this gene is a receptor for interleukin 7 (IL7). The function of this receptor requires the interleukin 2 receptor, gamma chain (IL2RG), which is a common gamma chain shared by the receptors of various cytokines, including interleukins 2, 4, 7, 9, and 15. This protein has been shown to play a critical role in V(D)J recombination during lymphocyte development. Defects in this gene may be associated with severe combined immunodeficiency (SCID). Alternatively spliced transcript variants have been found.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0672]
Molekulargewicht: 52kDa
NCBI: 3575
UniProt: P16871
Reinheit: Affinity purification
Sequenz: PESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPESFGRDSSLTCLAGNVSACDAPILSSSRSLDCRESGKNGPHV
Target-Kategorie: IL7R
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:2000|IF-P,1:100 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Immunology Inflammation,CDs,Cytokines,Interleukins,Cell Intrinsic Innate Immunity Signaling Pathway,Stem Cells,Hematopoietic Progenitors