CD127/IL7R Rabbit mAb, Unconjugated

Catalog Number: ABB-A11678
Article Name: CD127/IL7R Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A11678
Supplier Catalog Number: A11678
Alternative Catalog Number: ABB-A11678-20UL,ABB-A11678-100UL,ABB-A11678-500UL,ABB-A11678-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ILRA, CD127, IL7RA, CDW127, IMD104, sIL-7R, lnc-IL7R, IL7Ralpha, IL-7Ralpha, IL-7R-alpha, CD127/IL7R
The protein encoded by this gene is a receptor for interleukin 7 (IL7). The function of this receptor requires the interleukin 2 receptor, gamma chain (IL2RG), which is a common gamma chain shared by the receptors of various cytokines, including interleukins 2, 4, 7, 9, and 15. This protein has been shown to play a critical role in V(D)J recombination during lymphocyte development. Defects in this gene may be associated with severe combined immunodeficiency (SCID). Alternatively spliced transcript variants have been found.
Clonality: Monoclonal
Clone Designation: [ARC0672]
Molecular Weight: 52kDa
NCBI: 3575
UniProt: P16871
Purity: Affinity purification
Sequence: PESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPESFGRDSSLTCLAGNVSACDAPILSSSRSLDCRESGKNGPHV
Target: IL7R
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:2000|IF-P,1:100 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Immunology Inflammation,CDs,Cytokines,Interleukins,Cell Intrinsic Innate Immunity Signaling Pathway,Stem Cells,Hematopoietic Progenitors.