HSP47/SERPINH1 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A11698
Artikelname: HSP47/SERPINH1 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A11698
Hersteller Artikelnummer: A11698
Alternativnummer: ABB-A11698-100UL,ABB-A11698-20UL,ABB-A11698-1000UL,ABB-A11698-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CBP1, CBP2, OI10, gp46, AsTP3, HSP47, PIG14, PPROM, RA-A47, SERPINH2, HSP47/SERPINH1
This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The encoded protein is localized to the endoplasmic reticulum and plays a role in collagen biosynthesis as a collagen-specific molecular chaperone. Autoantibodies to the encoded protein have been found in patients with rheumatoid arthritis. Expression of this gene may be a marker for cancer, and nucleotide polymorphisms in this gene may be associated with preterm birth caused by preterm premature rupture of membranes. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0681]
Molekulargewicht: 46kDa
NCBI: 871
UniProt: P50454
Reinheit: Affinity purification
Sequenz: KHLAGLGLTEAIDKNKADLSRMSGKKDLYLASVFHATAFELDTDGNPFDQDIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRPKGDKMRDEL
Target-Kategorie: SERPINH1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:2000|IHC-P,1:100 - 1:800|IF/ICC,1:100 - 1:400|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse, ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction.