HSP47/SERPINH1 Rabbit mAb, Unconjugated

Catalog Number: ABB-A11698
Article Name: HSP47/SERPINH1 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A11698
Supplier Catalog Number: A11698
Alternative Catalog Number: ABB-A11698-100UL,ABB-A11698-20UL,ABB-A11698-1000UL,ABB-A11698-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CBP1, CBP2, OI10, gp46, AsTP3, HSP47, PIG14, PPROM, RA-A47, SERPINH2, HSP47/SERPINH1
This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The encoded protein is localized to the endoplasmic reticulum and plays a role in collagen biosynthesis as a collagen-specific molecular chaperone. Autoantibodies to the encoded protein have been found in patients with rheumatoid arthritis. Expression of this gene may be a marker for cancer, and nucleotide polymorphisms in this gene may be associated with preterm birth caused by preterm premature rupture of membranes. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9.
Clonality: Monoclonal
Clone Designation: [ARC0681]
Molecular Weight: 46kDa
NCBI: 871
UniProt: P50454
Purity: Affinity purification
Sequence: KHLAGLGLTEAIDKNKADLSRMSGKKDLYLASVFHATAFELDTDGNPFDQDIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRPKGDKMRDEL
Target: SERPINH1
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:2000|IHC-P,1:100 - 1:800|IF/ICC,1:100 - 1:400|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse, ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction.