P2RX5 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A11710
Artikelname: P2RX5 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A11710
Hersteller Artikelnummer: A11710
Alternativnummer: ABB-A11710-20UL,ABB-A11710-100UL,ABB-A11710-1000UL,ABB-A11710-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: P2X5, LRH-1, P2X5R, P2RX5
The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream gene, TAX1BP3 (Tax1 binding protein 3).
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 5026
UniProt: Q93086
Reinheit: Affinity purification
Sequenz: KKREFYRDKKYEEVRGLEDSSQEAEDEASGLGLSEQLTSGPGLLGMPEQQELQEPPEAKRGSSSQKGNGSVCPQLLEPHRST
Target-Kategorie: P2RX5
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IF-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Neuroscience.