P2RX5 Rabbit pAb, Unconjugated

Catalog Number: ABB-A11710
Article Name: P2RX5 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A11710
Supplier Catalog Number: A11710
Alternative Catalog Number: ABB-A11710-20UL,ABB-A11710-100UL,ABB-A11710-1000UL,ABB-A11710-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: P2X5, LRH-1, P2X5R, P2RX5
The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream gene, TAX1BP3 (Tax1 binding protein 3).
Clonality: Polyclonal
Molecular Weight: 47kDa
NCBI: 5026
UniProt: Q93086
Purity: Affinity purification
Sequence: KKREFYRDKKYEEVRGLEDSSQEAEDEASGLGLSEQLTSGPGLLGMPEQQELQEPPEAKRGSSSQKGNGSVCPQLLEPHRST
Target: P2RX5
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IF-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Neuroscience.