RUNX2 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A11753
Artikelname: RUNX2 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A11753
Hersteller Artikelnummer: A11753
Alternativnummer: ABB-A11753-100UL,ABB-A11753-20UL,ABB-A11753-1000UL,ABB-A11753-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IP, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CCD, AML3, CCD1, CLCD, OSF2, CBFA1, OSF-2, PEA2aA, PEBP2aA, CBF-alpha-1, RUNX2
This gene is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Two regions of potential trinucleotide repeat expansions are present in the N-terminal region of the encoded protein, and these and other mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants that encode different protein isoforms result from the use of alternate promoters as well as alternate splicing.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0362]
Molekulargewicht: 57kDa
NCBI: 860
UniProt: Q13950
Reinheit: Affinity purification
Sequenz: PRRISDDDTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSGPFQT
Target-Kategorie: RUNX2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IP,0.5µg-4µg antibody for 400µg-600µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse, ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology,Extracellular Matrix,Bone,Stem Cells,Mesenchymal Stem Cells.