RUNX2 Rabbit mAb, Unconjugated

Catalog Number: ABB-A11753
Article Name: RUNX2 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A11753
Supplier Catalog Number: A11753
Alternative Catalog Number: ABB-A11753-100UL,ABB-A11753-20UL,ABB-A11753-1000UL,ABB-A11753-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IP, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CCD, AML3, CCD1, CLCD, OSF2, CBFA1, OSF-2, PEA2aA, PEBP2aA, CBF-alpha-1, RUNX2
This gene is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Two regions of potential trinucleotide repeat expansions are present in the N-terminal region of the encoded protein, and these and other mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants that encode different protein isoforms result from the use of alternate promoters as well as alternate splicing.
Clonality: Monoclonal
Clone Designation: [ARC0362]
Molecular Weight: 57kDa
NCBI: 860
UniProt: Q13950
Purity: Affinity purification
Sequence: PRRISDDDTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSGPFQT
Target: RUNX2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IP,0.5µg-4µg antibody for 400µg-600µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse, ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology,Extracellular Matrix,Bone,Stem Cells,Mesenchymal Stem Cells.