Glucagon Rabbit mAb, Unconjugated

Artikelnummer: ABB-A11767
Artikelname: Glucagon Rabbit mAb, Unconjugated
Artikelnummer: ABB-A11767
Hersteller Artikelnummer: A11767
Alternativnummer: ABB-A11767-20UL,ABB-A11767-100UL,ABB-A11767-1000UL,ABB-A11767-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: GLP1, GLP2, GRPP, GLP-1, Glucagon
The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0382]
Molekulargewicht: 21kDa
NCBI: 2641
UniProt: P01275
Reinheit: Affinity purification
Sequenz: MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAE
Target-Kategorie: GCG
Antibody Type: Primary Antibody
Application Verdünnung: IF-P,1:50 - 1:200|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat, ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Endocrine and metabolic diseases,Diabetes,Neuroscience,Stem Cells,Cardiovascular,Heart,Cardiovascular diseases,Heart disease.
Immunohistochemistry a