Glucagon Rabbit mAb, Unconjugated

Catalog Number: ABB-A11767
Article Name: Glucagon Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A11767
Supplier Catalog Number: A11767
Alternative Catalog Number: ABB-A11767-20UL,ABB-A11767-100UL,ABB-A11767-1000UL,ABB-A11767-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: GLP1, GLP2, GRPP, GLP-1, Glucagon
The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.
Clonality: Monoclonal
Clone Designation: [ARC0382]
Molecular Weight: 21kDa
NCBI: 2641
UniProt: P01275
Purity: Affinity purification
Sequence: MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAE
Target: GCG
Antibody Type: Primary Antibody
Application Dilute: IF-P,1:50 - 1:200|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat, ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Endocrine and metabolic diseases,Diabetes,Neuroscience,Stem Cells,Cardiovascular,Heart,Cardiovascular diseases,Heart disease.
Immunohistochemistry a