[KO Validated] SERPINB5 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: [KO Validated] SERPINB5 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A1179
• Hersteller Artikelnummer: A1179
• Alternativnummer: ABB-A1179-100UL,ABB-A1179-20UL,ABB-A1179-1000UL,ABB-A1179-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: PI5, maspin, B5

Produktbeschreibung

Predicted to enable serine-type endopeptidase inhibitor activity. Predicted to be involved in negative regulation of endopeptidase activity. Predicted to act upstream of or within several processes, including extracellular matrix organization, prostate gland morphogenesis, and regulation of epithelial cell proliferation. Located in cytoplasm. Biomarker of hepatocellular carcinoma.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 42kDa
• NCBI: 5268
• UniProt: P36952
• Reinheit: Affinity purification
• Sequenz: EKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHFENVKDVPFGFQTVTSDVNKLSSFYSLKLIKRLYVDKSLNLSTEFISSTKRPYAKELETVDFKDKLEETKGQINNSIKDLTDGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFSESETKECPFRVNK
• Target-Kategorie: SERPINB5
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse, ResearchArea: Cancer,Tumor suppressors.