[KO Validated] SERPINB5 Rabbit pAb, Unconjugated

Product Overview

• Article Name: [KO Validated] SERPINB5 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A1179
• Supplier Catalog Number: A1179
• Alternative Catalog Number: ABB-A1179-100UL,ABB-A1179-20UL,ABB-A1179-1000UL,ABB-A1179-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: PI5, maspin, B5

Product Description

Predicted to enable serine-type endopeptidase inhibitor activity. Predicted to be involved in negative regulation of endopeptidase activity. Predicted to act upstream of or within several processes, including extracellular matrix organization, prostate gland morphogenesis, and regulation of epithelial cell proliferation. Located in cytoplasm. Biomarker of hepatocellular carcinoma.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 42kDa
• NCBI: 5268
• UniProt: P36952
• Purity: Affinity purification
• Sequence: EKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHFENVKDVPFGFQTVTSDVNKLSSFYSLKLIKRLYVDKSLNLSTEFISSTKRPYAKELETVDFKDKLEETKGQINNSIKDLTDGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFSESETKECPFRVNK
• Target: SERPINB5
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse, ResearchArea: Cancer,Tumor suppressors.