Snail Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: Snail Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A11794
• Hersteller Artikelnummer: A11794
• Alternativnummer: ABB-A11794-100UL,ABB-A11794-20UL,ABB-A11794-1000UL,ABB-A11794-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: SNA, SNAH, SNAIL, SLUGH2, SNAIL1, dJ710H13.1, Snail

Produktbeschreibung

The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein, and is also thought to be critical for mesoderm formation in the developing embryo. At least two variants of a similar processed pseudogene have been found on chromosome 2.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 29kDa
• NCBI: 6615
• UniProt: O95863
• Reinheit: Affinity purification
• Sequenz: RTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR
• Target-Kategorie: SNAI1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cancer,Cardiovascular,Heart,Cardiogenesis.

Bilder