Snail Rabbit pAb, Unconjugated

Product Overview

• Article Name: Snail Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A11794
• Supplier Catalog Number: A11794
• Alternative Catalog Number: ABB-A11794-100UL,ABB-A11794-20UL,ABB-A11794-1000UL,ABB-A11794-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: SNA, SNAH, SNAIL, SLUGH2, SNAIL1, dJ710H13.1, Snail

Product Description

The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein, and is also thought to be critical for mesoderm formation in the developing embryo. At least two variants of a similar processed pseudogene have been found on chromosome 2.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 29kDa
• NCBI: 6615
• UniProt: O95863
• Purity: Affinity purification
• Sequence: RTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR
• Target: SNAI1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cancer,Cardiovascular,Heart,Cardiogenesis.

Images