RAB5A Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: RAB5A Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A1180
• Hersteller Artikelnummer: A1180
• Alternativnummer: ABB-A1180-20UL,ABB-A1180-100UL,ABB-A1180-500UL,ABB-A1180-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: RAB5, RAB5A

Produktbeschreibung

Enables GDP binding activity, GTP binding activity, and GTPase activity. Involved in several processes, including amyloid-beta clearance by transcytosis, early endosome to late endosome transport, and regulation of exocytosis. Located in several cellular components, including cytoplasmic side of early endosome membrane, nucleoplasm, and terminal bouton.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 24kDa
• NCBI: 5868
• UniProt: P20339
• Reinheit: Affinity purification
• Sequenz: MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
• Target-Kategorie: RAB5A
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Neuroscience, Cell Type Marker,Neurodegenerative Diseases,Neuron marker,Synapse marker.

Bilder