RAB5A Rabbit pAb, Unconjugated

Product Overview

• Article Name: RAB5A Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A1180
• Supplier Catalog Number: A1180
• Alternative Catalog Number: ABB-A1180-20UL,ABB-A1180-100UL,ABB-A1180-500UL,ABB-A1180-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: RAB5, RAB5A

Product Description

Enables GDP binding activity, GTP binding activity, and GTPase activity. Involved in several processes, including amyloid-beta clearance by transcytosis, early endosome to late endosome transport, and regulation of exocytosis. Located in several cellular components, including cytoplasmic side of early endosome membrane, nucleoplasm, and terminal bouton.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 24kDa
• NCBI: 5868
• UniProt: P20339
• Purity: Affinity purification
• Sequence: MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
• Target: RAB5A
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Neuroscience, Cell Type Marker,Neurodegenerative Diseases,Neuron marker,Synapse marker.

Images