ISG15 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: ISG15 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A1182
• Hersteller Artikelnummer: A1182
• Alternativnummer: ABB-A1182-100UL,ABB-A1182-20UL,ABB-A1182-500UL,ABB-A1182-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: G1P2, IP17, UCRP, IFI15, IMD38, hUCRP, ISG15

Produktbeschreibung

The protein encoded by this gene is a ubiquitin-like protein that is conjugated to intracellular target proteins upon activation by interferon-alpha and interferon-beta. Several functions have been ascribed to the encoded protein, including chemotactic activity towards neutrophils, direction of ligated target proteins to intermediate filaments, cell-to-cell signaling, and antiviral activity during viral infections. While conjugates of this protein have been found to be noncovalently attached to intermediate filaments, this protein is sometimes secreted.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 18kDa
• NCBI: 9636
• UniProt: P05161
• Reinheit: Affinity purification
• Sequenz: MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS
• Target-Kategorie: ISG15
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:4000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Rat, ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Ubiquitin.

Bilder