ISG15 Rabbit pAb, Unconjugated

Catalog Number: ABB-A1182
Article Name: ISG15 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A1182
Supplier Catalog Number: A1182
Alternative Catalog Number: ABB-A1182-100UL,ABB-A1182-20UL,ABB-A1182-500UL,ABB-A1182-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: G1P2, IP17, UCRP, IFI15, IMD38, hUCRP, ISG15
The protein encoded by this gene is a ubiquitin-like protein that is conjugated to intracellular target proteins upon activation by interferon-alpha and interferon-beta. Several functions have been ascribed to the encoded protein, including chemotactic activity towards neutrophils, direction of ligated target proteins to intermediate filaments, cell-to-cell signaling, and antiviral activity during viral infections. While conjugates of this protein have been found to be noncovalently attached to intermediate filaments, this protein is sometimes secreted.
Clonality: Polyclonal
Molecular Weight: 18kDa
NCBI: 9636
UniProt: P05161
Purity: Affinity purification
Sequence: MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS
Target: ISG15
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:4000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Rat, ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Ubiquitin.