PDGFB Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: PDGFB Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A1195
• Hersteller Artikelnummer: A1195
• Alternativnummer: ABB-A1195-100UL,ABB-A1195-20UL,ABB-A1195-1000UL,ABB-A1195-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: SIS, SSV, IBGC5, PDGF2, c-sis, PDGF-2, PDGFB

Produktbeschreibung

This gene encodes a member of the protein family comprised of both platelet-derived growth factors (PDGF) and vascular endothelial growth factors (VEGF). The encoded preproprotein is proteolytically processed to generate platelet-derived growth factor subunit B, which can homodimerize, or alternatively, heterodimerize with the related platelet-derived growth factor subunit A. These proteins bind and activate PDGF receptor tyrosine kinases, which play a role in a wide range of developmental processes. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 17, at sites where this gene and that for collagen type 1, alpha 1 are located, are associated with dermatofibrosarcoma protuberans, a rare skin tumor. Alternative splicing results in multiple transcript variants.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 27kDa
• NCBI: 5155
• UniProt: P01127
• Reinheit: Affinity purification
• Sequenz: QCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGA
• Target-Kategorie: PDGFB
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Rat, ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Growth factors,Endocrine Metabolism,Immunology Inflammation,Cytokines,Cardiovascular,Angiogenesis,Blood,Serum Proteins,Hypoxia,Heart,Cardiovascular diseases,Heart disease.

Bilder