PDGFB Rabbit pAb, Unconjugated

Catalog Number: ABB-A1195
Article Name: PDGFB Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A1195
Supplier Catalog Number: A1195
Alternative Catalog Number: ABB-A1195-100UL,ABB-A1195-20UL,ABB-A1195-1000UL,ABB-A1195-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SIS, SSV, IBGC5, PDGF2, c-sis, PDGF-2, PDGFB
This gene encodes a member of the protein family comprised of both platelet-derived growth factors (PDGF) and vascular endothelial growth factors (VEGF). The encoded preproprotein is proteolytically processed to generate platelet-derived growth factor subunit B, which can homodimerize, or alternatively, heterodimerize with the related platelet-derived growth factor subunit A. These proteins bind and activate PDGF receptor tyrosine kinases, which play a role in a wide range of developmental processes. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 17, at sites where this gene and that for collagen type 1, alpha 1 are located, are associated with dermatofibrosarcoma protuberans, a rare skin tumor. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 27kDa
NCBI: 5155
UniProt: P01127
Purity: Affinity purification
Sequence: QCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGA
Target: PDGFB
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Rat, ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Growth factors,Endocrine Metabolism,Immunology Inflammation,Cytokines,Cardiovascular,Angiogenesis,Blood,Serum Proteins,Hypoxia,Heart,Cardiovascular diseases,Heart disease.