SPRR3 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A12041
Artikelname: SPRR3 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A12041
Hersteller Artikelnummer: A12041
Alternativnummer: ABB-A12041-20UL,ABB-A12041-100UL,ABB-A12041-1000UL,ABB-A12041-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: SPRR3
Predicted to enable structural molecule activity. Predicted to be involved in wound healing. Located in Golgi apparatus and perinuclear region of cytoplasm.
Klonalität: Polyclonal
Molekulargewicht: 17kDa
NCBI: 6707
UniProt: Q9UBC9
Reinheit: Affinity purification
Sequenz: MSSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVP
Target-Kategorie: SPRR3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cell Biology Developmental Biology,Cell Adhesion,Neuroscience.