SPRR3 Rabbit pAb, Unconjugated

Product Overview

• Article Name: SPRR3 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A12041
• Supplier Catalog Number: A12041
• Alternative Catalog Number: ABB-A12041-20UL,ABB-A12041-100UL,ABB-A12041-1000UL,ABB-A12041-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: SPRR3

Product Description

Predicted to enable structural molecule activity. Predicted to be involved in wound healing. Located in Golgi apparatus and perinuclear region of cytoplasm.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 17kDa
• NCBI: 6707
• UniProt: Q9UBC9
• Purity: Affinity purification
• Sequence: MSSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVP
• Target: SPRR3
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cell Biology Developmental Biology,Cell Adhesion,Neuroscience.

Images