POLK Rabbit pAb, Unconjugated

Artikelnummer: ABB-A12052
Artikelname: POLK Rabbit pAb, Unconjugated
Artikelnummer: ABB-A12052
Hersteller Artikelnummer: A12052
Alternativnummer: ABB-A12052-20UL,ABB-A12052-100UL,ABB-A12052-500UL,ABB-A12052-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: DINP, POLQ, DINB1, POLK
This gene encodes a member of the DNA polymerase type-Y family of proteins. The encoded protein is a specialized DNA polymerase that catalyzes translesion DNA synthesis, which allows DNA replication in the presence of DNA lesions. Human cell lines lacking a functional copy of this gene exhibit impaired genome integrity and enhanced susceptibility to oxidative damage. Mutations in this gene that impair enzyme activity may be associated with prostate cancer in human patients.
Klonalität: Polyclonal
Molekulargewicht: 99kDa
NCBI: 51426
UniProt: Q9UBT6
Reinheit: Affinity purification
Sequenz: MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRNLS
Target-Kategorie: POLK
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling.