POLK Rabbit pAb, Unconjugated

Catalog Number: ABB-A12052
Article Name: POLK Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A12052
Supplier Catalog Number: A12052
Alternative Catalog Number: ABB-A12052-20UL,ABB-A12052-100UL,ABB-A12052-500UL,ABB-A12052-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: DINP, POLQ, DINB1, POLK
This gene encodes a member of the DNA polymerase type-Y family of proteins. The encoded protein is a specialized DNA polymerase that catalyzes translesion DNA synthesis, which allows DNA replication in the presence of DNA lesions. Human cell lines lacking a functional copy of this gene exhibit impaired genome integrity and enhanced susceptibility to oxidative damage. Mutations in this gene that impair enzyme activity may be associated with prostate cancer in human patients.
Clonality: Polyclonal
Molecular Weight: 99kDa
NCBI: 51426
UniProt: Q9UBT6
Purity: Affinity purification
Sequence: MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRNLS
Target: POLK
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling.