DEFB121 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: DEFB121 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A1208
• Hersteller Artikelnummer: A1208
• Alternativnummer: ABB-A1208-20UL,ABB-A1208-100UL,ABB-A1208-500UL,ABB-A1208-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: DEFB21, ESC42RELC, DEFB121

Produktbeschreibung

This gene encodes a member of the beta subfamily of defensins. Beta-defensins are antimicrobial peptides that protect tissues and organs from infection by a variety of microorganisms. This gene is found in a cluster with other beta-defensin genes on the long arm of chromosome 20. Two transcript variants encoding different isoforms have been found for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 8kDa
• NCBI: 245934
• UniProt: Q5J5C9
• Reinheit: Affinity purification
• Sequenz: MKLLLLLLTVTLLLAQVTPVMKCWGKSGRCRTTCKESEVYYILCKTEAKCCVDPKYVPVKPKLTDTNTSLESTSAV
• Target-Kategorie: DEFB121
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: IF-P,1:50 - 1:100|IHC-P,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat

Bilder

Immunofluorescence analysis of